PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00029649001
Common NameGSBRNA2T00029649001, LOC106446876
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 266aa    MW: 29722.1 Da    PI: 6.5148
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00029649001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.32.1e-18194228135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C ttkTp+WR+gp g+ktLCnaCG+++r+ +l
  GSBRNA2T00029649001 194 CTHCETTKTPQWREGPCGPKTLCNACGVRFRSGRL 228
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.9E-16188238IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.33E-14192251No hitNo description
PROSITE profilePS5011411.49192224IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.7E-14192225IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440194219IPR000679Zinc finger, GATA-type
CDDcd002026.13E-15194230No hitNo description
PfamPF003203.4E-16194228IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MNNGGSWLPE EELKGLSENF FDDLINHTDL LLEEDMETGN DDDEGDWDAK FENLVPPPLD  60
VLSSEFTHGL RKPVPTLRQS SSSEVSSTID NSLHDVKVST LFQSSSALSV LANGSVSFPL  120
KGTRSNLRKR PTPPTFRSLK SFASEMVQQF APDDPDSETY LPFAKKKRQR KNKDQSSVSD  180
SPQQFNADGT IRMCTHCETT KTPQWREGPC GPKTLCNACG VRFRSGRLLP EYRPSSSPSF  240
IPSLHSNSHR KIIEMRRKYQ DLQPG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164169KKKRQR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.278300.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744142.10.0PREDICTED: putative GATA transcription factor 13 isoform X1
RefseqXP_013744141.10.0PREDICTED: putative GATA transcription factor 13 isoform X2
RefseqXP_013744140.10.0PREDICTED: putative GATA transcription factor 13 isoform X2
RefseqXP_013744139.10.0PREDICTED: putative GATA transcription factor 13 isoform X1
RefseqXP_013636766.10.0PREDICTED: putative GATA transcription factor 13
RefseqXP_013636765.10.0PREDICTED: putative GATA transcription factor 13
RefseqXP_013636764.10.0PREDICTED: putative GATA transcription factor 13
RefseqXP_013636763.10.0PREDICTED: putative GATA transcription factor 13
SwissprotQ9SKN61e-81GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLA0A078K3U30.0A0A078K3U3_BRANA; BnaCnng77580D protein
TrEMBLA0A0D3C2J30.0A0A0D3C2J3_BRAOL; Uncharacterized protein
STRINGBra035708.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.15e-72GATA transcription factor 13
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]